LOCUS       XELHOMXIH     624 bp    mRNA            VRT       17-JUL-1995
DEFINITION  X.laevis homeo box region mRNA.
ACCESSION   M17447
NID         g214256
KEYWORDS    homeo box.
SOURCE      Xenopus laevis (clone:  XIHbox6.) cDNA to mRNA.
  ORGANISM  Xenopus laevis
            Eukaryotae; mitochondrial eukaryotes; Metazoa; Chordata;
            Vertebrata; Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea;
            Pipidae; Xenopodinae; Xenopus.
REFERENCE   1  (bases 1 to 624)
  AUTHORS   Sharpe,C.R., Fritz,A., De Robertis,E.M. and Gurdon,J.B.
  TITLE     A homeobox-containing marker of posterior neural differentiation
            shows the importance of predetermination in neural induction
  JOURNAL   Cell 50 (5), 749-758 (1987)
  MEDLINE   87301718
COMMENT     Draft entry and computer-readable sequence [1] kindly submitted by
            C.R.Sharpe, 23-NOV-1988.
FEATURES             Location/Qualifiers
     source          1..624
                     /organism="Xenopus laevis"
                     /clone="XIHbox6."
     CDS             106..>624
                     /note="putative"
                     /codon_start=1
                     /product="homeobox protein"
                     /db_xref="PID:g901848"
                     /translation="MGLDAHRVARLDLARIPLCAIPQPRAPAQSEPLDFPSCSFSASW
                     NPLTPHPPVYQPYIQQQQQEEGAPSAEGRYLRAWLDNGPSLKSEPLLGPPGTNWDPNI
                     TLWPPGGAAANTERSTHSGNFPDTKGTEGTAGDTDRTHQNNPSANWLHARSSRKKRCP
                     YSKYQTLELEKEF"
     repeat_region   280..294
                     /note="M-repeat"
     misc_feature    562..624
                     /note="homeo box"
BASE COUNT      123 a    227 c    166 g    108 t
ORIGIN
            149 bp upstream of EcoRI site.
        1 ggtccggctt tcctcggtct cctcgtagga tgcgtctgcg cctacggact gcggcctcgt
       61 ctgcgtccgg ggcgaccccc ttgactacga ggtccagcgc tgctgatggg cctcgacgcg
      121 caccgtgtcg cccggcttga cctcgcgcga attccgctct gcgcaattcc ccaaccccgg
      181 gcccctgcgc aatctgaacc cctggacttt ccctcctgca gtttcagcgc ctcctggaac
      241 cccctgaccc cgcaccctcc agtctatcag ccctatatcc aacagcagca gcaggaggag
      301 ggcgccccca gtgccgaggg caggtactta cgggcttggc tggacaatgg accgagtctc
      361 aagtctgagc cgctgctggg gcccccgggg acaaactggg accccaacat tacactgtgg
      421 cctcccggcg gcgctgctgc aaatactgaa cgttccactc acagcggcaa cttccccgac
      481 actaaaggga ctgaaggaac cgccggggac actgaccgga ctcatcaaaa caacccctca
      541 gccaactggt tacacgctcg ctcctccaga aagaagaggt gcccctactc caaataccag
      601 accctggagc tggagaagga attc
//

Return to the XMMR marker index